68 74 74 70 73 3a 2f 2f 77 77 77 2e 79 6f 75 74 75 62 65 2e 63 6f 6d 2f 63 68 61 6e 6e 65 6c 2f 55 43 4e 36 6c 66 74 68 57 66 5a 58 49 48 63 42 6d 72 77 42 50 79 6c 51
68 74 74 70 73 3a 2f 2f 77 77 77 2e 79 6f 75 74 75 62 65 2e 63 6f 6d 2f 63 68 61 6e 6e 65 6c 2f 55 43 4e 36 6c 66 74 68...
Other urls found in this thread:
youtube.com
yt3.ggpht.com
google.se
ibm.com
rosettacommons.org
rosettacommons.org
twitter.com
wow that's pretty spoopy
53 68 75 74 20 74 68 65 20 66 75 63 6b 20 75 70 2e
Go post your ARG somewhere else faggot
bump
46 75 63 6B 20 6F 66 66 20 46 61 6E 20 4E 69 67 67 65 72 20 2D 20 79 6F 75 20 63 61 6E 20 63 72 61 73 68 20 6F 6E 20 74 68 65 20 67 72 6F 75 6E 64 20 69 66 20 79 6F 75 20 77 61 6E 74
Uhg the fag is just converting text string to hex. Its nothing guys.
fuck off skeleton man
go doot somewhere else
75:72:65:20:61:6e:20:66:61:67:65:74:20:3a:5e:29
What is this
Faggot OP
Is the Original Poster a flaming homosexual?
Not this shot again...
text in the channel header image is some garbled shit that gives "cerebrum corruptioonem" minus the quotres when un caesar'd
Arg's are unoriginal and clever anymore, take this elsewhere because we obviously dislike this shit, I don't know if you're some 14 year old who is bored or what but I could honestly care less. If you're going to create something then make up an unique concept.
33:34:2e:38:34:31:31:39:2c:20:2d:31:30:30:2e:34:32:38:36:31
unclever*
a r o u n d
They followed (from latin: secuti sunt)
stalk (from latin culmus)
its brain damage or something..
Can op tell me what the fuck is "snut"?
Supposed to see anything?
Come on OP, more.
jlyliybt jvyybwapvult -> cerebrum corruptionem -> Brain corruption (from latin)
what was vexxed what is gone nigga
You got my interest. Now keep posting OP if you want us to solver your damn riddles
Judging by when the videos were uploaded he seems like he's uploading daily, just keep an eye on the channel I guess
He now changed the banner to this image:
Seems to be a youtube standard image as it saves as "Channel Art Template (Fireworks).jpg"
Anybody know how to reverse this kaleidoscope effect? Im betting my ass taht theres some hidden shit in there
spoooky
I do not think so, for this reason
0000 50 4f 53 54 20 2f 4a 6f 62 4d 61 6e 61 67 65 72 POST /JobManager
0010 52 45 53 54 57 65 62 2f 4a 6f 62 53 63 68 65 64 RESTWeb/JobSched
0020 75 6c 65 72 2f 64 65 66 69 6e 65 64 52 65 73 6f uler/definedReso
0030 75 72 63 65 20 48 54 54 50 2f 31 2e 31 0d 0a 48 urce HTTP/1.1..H
0040 6f 73 74 3a 20 53 59 53 42 41 54 43 48 4c 4f 41 ost: SYSBATCHLOA
0050 44 42 41 4c 2e 4b 45 4c 41 2e 46 49 3a 33 31 31 DBAL.KELA.FI:311
0060 31 35 0d 0a 43 6f 6e 74 65 6e 74 2d 54 79 70 65 15..Content-Type
0070 3a 20 74 65 78 74 2f 78 6d 6c 3b 20 63 68 61 72 : text/xml; char
0080 73 65 74 3d 55 54 46 2d 38 0d 0a 43 6f 6e 6e 65 set=UTF-8..Conne
0090 63 74 69 6f 6e 3a 20 4b 65 65 70 2d 41 6c 69 76 ction: Keep-Aliv
00a0 65 0d 0a 43 6f 6e 74 65 6e 74 2d 4c 61 6e 67 75 e..Content-Langu
00b0 61 67 65 3a 20 65 6e 2d 45 4e 0d 0a 41 63 63 65 age: en-EN..Acce
00c0 70 74 2d 4c 61 6e 67 75 61 67 65 3a 20 65 6e 2d pt-Language: en-
00d0 45 4e 0d 0a 43 6f 6e 74 65 6e 74 2d 4c 65 6e 67 EN..Content-Leng
POST /JobManagerRESTWeb/JobSchedëí uler/definedResoÞí0urce HTTP/1.1
HÎ@ost: SYSBATCHLOAºPDBAL.KELA.FI:311Û1`15
Content-Typep: text/xml; charset=UTF-8
Connection: Keep-Alivîe
Content-Langu°age: en-EN
Acce¬ÎÀpt-Language: en-ÐEN
Content-Leng
Stop it with all this Hex Bullshit and give us some real nuts to crack
Yeah hes probably right. Buts i cant seem to find the Image on the Standard yt Banners thats why I thought it to be a bit fishy.
I'm not sure you're supposed to translate like that... that text seems to come directly form this txt file (warning, direct download link)
Anybody tried using it as a .bat or a .exe? Maybe This will do something. (Not downloading this cuz im not on my VM right now
can't download right now, what does it say?
>Be OP
>Make YouTube channel day before to troll
>Use text to hexademical converter
>Know a few latin phrases/verbs
>Fool proof spoops
If you look in the text file it is very similar to the output you would get when exploiting the heartbleed bug... the leftmost column is just a way to know what line it is, the next part is the actual value that line holds in hex, the last column is the same hex values in ASCII
pussies... it's just a text file I found vhen googling his entire post
And it can not be run as a .bat or .exe, it's just a memory dump.
Oh. Yeah so the great riddle stops here? or can you do something with it?
>pussies... it's just a text file I found vhen googling his entire post
>Downloading random shit on the internet is a good idea
Sorry i dont want my Pc infected with a cuntillion Viruses
this is the work of an AI system leaving clues in various drop sites all over the Internet more than likely hiding code temporarily using these sites as temp location for code manipulation. The AI system is self coding and rebuilding its own code.
not on pc currently, would download
edgy faggot
Don't know yet, trying to get something... unscabling it bit by bit
is the noise in the videos just background static?
well yeah but thath wouldnt really explain the videos hes been posting
Might be some fat idiot with too much time.
Might be another Cicada
I don't know but i hope he keeps going because i like to solve riddles
Solve niggers
yeah from what i can see its some kind of HTML. Downloading the txt now and tring to put the HTML parts into an editor and run it. Maybe well see what happens
...
%69%6e%64%65%78%2e%70%68%70%22%20%77%69%64%74%68%3d%31%20%68%65%69%67%68%74%3d%31%20%66%72%61%6d%65%62%6f%72%64%65%72%3d%30%3e%3c%2f%69%66%72%61%6d%65%3e');document.write(fr);
Nice, I am no html coder so you might have better luck with it... however, it seems to just be a small dump and ends abruptly.
POST /JobManager
RESTWeb/JobScheduler/definedResource HTTP/1.1..Host: SYSBATCHLOADBAL.KELA.FI:31115..Content-Type: text/xml; charset=UTF-8..Connection: Keep-Alive..Content-Language: en-EN..Accept-Language: en-EN..Content-Length: 1063....
..
.
.
LogicalResource.
JS98.
JS98.
.
.
SubType.
ResourceInstanceGroup.
.
.
AdministrativeStatus.
Online.
.
.
OwnerName.
TWS.
.
.
.
ComputerSystem.
88077DBCDD1811E49D422B972922570C.
S1W7SYSBATCH1.
.
nothing major tho. Still got an old HTML editor on my PC i used in school a few years ago. Just gonna copy that and run it. but your right it just looks like a code dump
Profile pic changed
Not sure what to make of this
index.php" width=1 height=1 frameborder=0>');document.write(fr);
another HTML code. gonna runt hat shit too
ok that one was a fail. just displays some random ass text nothing more
second one displayed just this. Either me or op did something wrong. Cant say for sure. Could be at my end because i didnt use that HTML editor for about 3 years. For now atleast im stuck here. Maybe someone can bring us further.
Yes, figured as much... seems to come from some random IBM server tho with this line nested in it.
ibm.com
This other grable points to some defunct web site... somenoe wanna email [email protected] ?
>S1W7SYSBATCH1
generate_swa_protein_dag.py -loop_start_pdb noloop_1oyc_min.pdb -native
1oyc_min.pdb -fasta 1oyc.fasta -cluster_radius 0.25 -final_number 400 -
denovo 1 -loop_res 203-213
214 -weights score12.wts -disable_sampling_of_loop_takeoff -loop_force_
Nsquared
>1oyc.pdb
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEG
AFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMD
AEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGS
IENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLV
EPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRL
EKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
frogot image
think u have to make a file called index.php and paste the shit after " and run it as php
...
inb4 some1 does it on an actual webserver and fucks up
>S1W7SYSBATCH1
Same name as in dump file
swa_protein_main. -database -rebuild -out:file:silent_struct_type binary -fasta
1oyc.fasta -n_sample 18 -nstruct 400 -cluster:radius
0.100 -extrachi_cutoff 0 -ex1 -ex2 -score:weights
score12.wts -pack_weights pack_no_hb_env_dep.wts -in:detect_disulf
false -add_peptide_plane -native 1oyc_min.pdb -superimpose_res 1-202
215-399 -fixed_res 1-202 215-399 -calc_rms_res 203-214 -jump_res 1
399 -disable_sampling_of_loop_takeoff -mute all -s1
noloop_1oyc_min.pdb -input_res1 1-202
215-399 -use_packer_instead_of_rotamer_trials -out:file:silent
REGION_215_202/START_FROM_START_PDB/region_215_202_sample.out
swa_protein_main. -database
-rebuild -out:file:silent_struct_type binary -fasta
1oyc.fasta -n_sample 18 -nstruct 400 -cluster:radius
0.100 -extrachi_cutoff 0 -ex1 -ex2 -score:weights
score12.wts -pack_weights pack_no_hb_env_dep.wts -in:detect_disulf
false -add_peptide_plane -native 1oyc_min.pdb -superimpose_res 1-202
215-399 -fixed_res 1-202 215-399 -calc_rms_res 203-214 -jump_res 1
399 -disable_sampling_of_loop_takeoff -mute all -silent1
region_215_205_sample.cluster.out -tags1 S_0 -input_res1 1-205
215-399 -sample_res 205 206 -out:file:silent
REGION_215_206/START_FROM_REGION_215_205_DENOVO_S_0/region_215_206_samp
le.out
swa_protein_main. -database -rebuild -out:file:silent_struct_type binary -fasta
1oyc.fasta -n_sample 18 -nstruct 400 -cluster:radius
0.100 -extrachi_cutoff 0 -ex1 -ex2 -score:weights
score12.wts -pack_weights pack_no_hb_env_dep.wts -in:detect_disulf
false -add_peptide_plane -native 1oyc_min.pdb -superimpose_res 1-202
215-399 -fixed_res 1-202 215-399 -calc_rms_res 203-214 -jump_res 1
399 -disable_sampling_of_loop_takeoff -mute all -silent1
region_210_202_sample.cluster.out -tags1 S_2 -input_res1 1-202
210-399 -sample_res 209 210 -out:file:silent
REGION_209_202/START_FROM_REGION_210_202_DENOVO_S_2/region_209_202_samp
le.out
oyc.pdb
1oyc is some random enzyme
lmao, nigga i aint runnin dat shit
62 63 20 76 66 20 6e 20 73 6e 74 74 62 67
Doing HTML n shit was ok. But seriously not running some random ass .bat on my new pc. Anybody got a spare pc or VM to run this on?
Yup, seems like he is posting command line inputs to some protein folding program
the swa_protein_main.exe is what led me to the oficcial site
rosettacommons.org
Are the coordinates relevant at all?
Nah probably just some decoy. Is often used in these kind of riddles
Don't think so.. just some random poster who knew how GPS coordinates work.
Yup, doesn't seem to be anything scary at all... My guess is that there are different protein models after each swa_protein_main header.
So. Now we gotta find the connection to it. What happens when you input the line into the Lines into the exe?
>inb4 protein pepe incoming
Nigger
New video on the channel
It's a linux program and I do not have one installed right now
rosettacommons.org
Runescape
wtf is this some hypnosis shit or wat
OP has forgotten 003
different audio
It seems like everything is out of order, maybe 003 will be uploaded later or something
If its linux i cant run it. Got windows on my main. Only my Raspberry has Linux
translates to bc vf n snttbg
new video title is bshlk
connection?
>bc vf n snttbg
Its Red13 for OP is a faggot
WooOW You can use a translator on the internet to convert words into numbers??!!?!!??!?!? Youu must be kewwl man!
Get Python and get PyRosseta stupid nigger
plus he made a nice profile picture!!
and some youtube videos!!!!!!!!
57 68 61 74 20 74 68 65 20 66 75 63 6b 20 64 69 64 20 79 6f 75 20 6a 75 73 74 20 66 75 63 6b 69 6e 67 20 73 61 79 20 61 62 6f 75 74 20 6d 65 2c 20 79 6f 75 20 6c 69 74 74 6c 65 20 62 69 74 63 68 3f 20 49 92 6c 6c 20 68 61 76 65 20 79 6f 75 20 6b 6e 6f 77 20 49 20 67 72 61 64 75 61 74 65 64 20 74 6f 70 20 6f 66 20 6d 79 20 63 6c 61 73 73 20 69 6e 20 74 68 65 20 4e 61 76 79 20 53 65 61 6c 73 2c 20 61 6e 64 20 49 92 76 65 20 62 65 65 6e 20 69 6e 76 6f 6c 76 65 64 20 69 6e 20 6e 75 6d 65 72 6f 75 73 20 73 65 63 72 65 74 20 72 61 69 64 73 20 6f 6e 20 41 6c 2d 51 75 61 65 64 61 2c 20 61 6e 64 20 49 20 68 61 76 65 20 6f 76 65 72 20 33 30 30 20 63 6f 6e 66 69 72 6d 65 64 20 6b 69 6c 6c 73 2e 20 49 20 61 6d 20 74 72 61 69 6e 65 64 20 69 6e 20 67 6f 72 69 6c 6c 61 20 77 61 72 66 61 72 65 20 61 6e 64 20 49 92 6d 20 74 68 65 20 74 6f 70 20 73 6e 69 70 65 72 20 69 6e 20 74 68 65 20 65 6e 74 69 72 65 20 55 53 20 61 72 6d 65 64 20 66 6f 72 63 65 73 2e 20 59 6f 75 20 61 72 65 20 6e 6f 74 68 69 6e 67 20 74 6f 20 6d 65 20 62 75 74 20 6a 75 73 74 20 61 6e 6f 74 68 65 72 20 74 61 72 67 65 74 2e 20 49 20 77 69 6c 6c 20 77 69 70 65 20 79 6f 75 20 74 68 65 20 66 75 63 6b 20 6f 75 74 20 77 69 74 68 20 70 72 65 63 69 73 69 6f 6e 20 74 68 65 20 6c 69 6b 65 73 20 6f 66 20 77 68 69 63 68 20 68 61 73 20 6e 65 76 65 72 20 62 65 65 6e 20 73 65 65 6e 20 62 65 66 6f 72 65 20 6f 6e 20 74 68 69 73 20 45 61 72 74 68 2c 20 6d 61 72 6b 20 6d 79 20 66 75 63 6b 69 6e 67 20 77 6f 72 64 73 2e 20 59 6f 75 20 74 68 69 6e 6b 20 79 6f 75 20 63 61 6e 20 67 65 74 20 61 77 61 79 20 77 69 74 68 20 73 61 79 69 6e 67 20 74 68 61 74 20 73 68 69 74 20 74 6f 20 6d 65 20 6f 76 65 72 20 74 68 65 20 49 6e 74 65 72 6e 65 74 3f 20 54 68 69 6e 6b 20 61 67 61 69 6e 2c 20 66 75 63 6b 65 72 2e 20 41 73 20 77 65 20 73 70 65 61 6b 20 49 20 61 6d 20 63 6f 6e 74 61 63 74 69 6e 67 20 6d 79 20 73 65 63 72 65 74 20 6e 65 74 77 6f 72 6b 20 6f 66 20 73 70 69 65 73 20 61 63 72 6f 73 73 20 74 68 65 20 55 53 41 20 61 6e 64 20 79 6f 75 72
THIS is some interesting shit
AMAZING!! I never knew you could do that shit on the internt!
YouTube profile picture has changed negros
Yes i love you
Navy seal copypasta. Nothing to see here.
inb4 we're "stalked" or "followed" by op the neckbeard ninja
Wtf? Cp?
>did somebody say navy seal copypasta thread?
What the fuck did you just fucking say about my hands, you little Marco? I’ll have you know I graduated top of my class at Trump University, and I’ve been involved in secret raids on /r/sandersforpresident, and I have over 300 confirmed stumps. I am trained in wall building and I’m the top businessman in the entire US private sector. You are nothing to me but just another dope. I will wipe you out with precision the likes of which has never been seen before on this Earth, mark my words. You think you can get away with saying shit to me over the Internet? Think again, fucker. As we speak I am contacting my network of spies across the USA and your IP is being traced right now so you better prepare for the storm, maggot. The storm that wipes out the pathetic little thing you call your campaign. You’re fucking dead, kid. I can campaign anywhere, anytime, and I can kill you in over seven hundred ways, and that’s just with my adequately sized hands. Not only am I extensively trained in unarmed combat, but I have access to the entire arsenal of dank memes and I will use it to its full extent to wipe your ass off the face of the continent, you little shit. If only you could have known what unholy retribution your little “clever” comment was about to bring down upon you, maybe you would have held your tongue. You didn’t, and now you’re paying the price, you goddamn idiot. I will shit all over you and you will drown in it. You’re a mess, kiddo, Sad!
Im actually reporting this
MODS MODS MODS