>You guys really disappoint me. It's HRC's DNA. I made it public to show the lab tech's working with the Chandra Levy investigation I will not stay quiet if they choose the wrong path.
LEFT VENTRICULAR CONNECTION DISCONNECTION EVENT DETECTED ECHO NO CONNECTION TO ICD PORT 8000 ESTABLISHED BY USER: SPEAKEASY AUTOMATIC SWITCH OUTPUT ENABLED EXOME SEQUENCE DUMP BEGIN SEQ 1/25723 msgdemifdptmskkkrkkrkpfmldeeggdtqaeetqlsetkevepepvedkdteadeedsrkkdasndlddltffnqkkkkkktkkifdideaeegikdlkiegdaqepvepeddldimlgkkkkkktvkfpdedevldkdealededskkddgisfssqsgpawagserdytydellnrvfnimreknpdmvagekrkfvmkppqvvrvgtkktsfvnftdickllhrqpkhllafllaelgtsgsidgnnqlvikgrfqqkqienvlrryikeyvtchtcrspdtilqkdtrlyflqcetchsrcsvasiktgfqavtgkraqlrakan SEQ 2/25723 meyrnlllgfllccillatsysymileekkdtnksavhtskikfpdlppisiveltktsmklsrkeaernksmkkkaqqkkaprpkpppppncvatwasckpssrpccdfcafcycrlfqtvcycrmgnpnc SEQ 3/25723 mnseskkqlnivvlgtafmfmftafqtcgnvaqtvitnlnntdfhgsgytsmaviygvfsasnlispsvvaiigpqismfisgifysiyiaifiqpstwtfytasvflgiaaavlwtaqgncltvnsnehtigrnsgifwallqsslffgnlyiyfawqgkfhisesdrrtvfialtvislvgtvlfflirtpeesnseeeppadnlmertsgpsvmtkavdafkrsiklcatkeivllsvttaytgleltffsgvygtcigavnkfgneeksliglsgifigigeilgggifgllsksnqfgrnpvvmlgivvhfiafylifynipndapiasidgtdsrafmepskevaifcsfllglgdscfntqllsilgflysedsapafaifkfiqsvcaaiayfysnylflqwqllimavvgffgtisffsvewaapafvakrtdyssi SEQ 4/25723 mqqlamsdtsaekphpshhstgavqmrirsvnsphdrhsqsksmilpenlkviepischrrnhsqhnltlpefispleqtvikegyllkakiadggkklrknwtsswlvltgqkiefykepkqpavanlkagyktewvdlrgahlewakeksskknvfqittlsgnevllqsdiefvilewfhaiknaieklpkekskmsrnneykimrssssellssfetdskepkpenrrslifrlnysisdtteinrvksrlkkfitrrpslrtlqekgiikgldvdgiyrvsgnlatiqklrfvvnqeeklnlddsqwedihvvtgalkmffrelpeplfpycffeqfvevikiqdytnrvkavrnlvqklprpnydtmkilfqhlqkiaakenmnlmtpqslgivfgptllrpeketgsmavymmyqnqlvelmlseyskifssekd
(cont)
Austin Phillips
god damn Lizards
Benjamin Perry
madfnvgaaathfipgvspvpgsaavaadlsgskyngdkdvrdfhilrrnqpvillvivasfavgallrtilkrkkipilvivffigviigtsqlpfvktiaeidpvlflhlfspviiftaafemdfyifqksfwqvlilavlgfvmncaslgwltyktnqhkwtrddniifgiilcttdpdlsvasiknigiskilinlikgeslfngatttivfelyrdlvnhsyqkivqeifvkltlkifgsavfgfvsskmvtfwlanifndritevilsfsmtylvfylaewlgmsgiiavcvlgllmdsvsfspgmdvvlskfwsmltflaqimiyltmgiviaqktfpymnfhsifyivtiylslnliralvtfilspllnrfgygfnwrwgavivwsgvrglftlnmalevsqtpnensaeleiknmillysvavslltlvinsttveklvmtlglcnvslpkrvalhnafqrikqmeannftmlkldkfladanwalaekcisvedpkeidsvvkqlmktfrcpncnvntplensqqmadimeearlrlltaqiasyqkqynsgmlsqkatqtligaaecyydvpgkfmnihevkkywedkgllmsmkkylsdwaynvkpetsrtsenrflklcqlivyndtfehtsslitylnfipillrliptvnmeflpqlkicnyyflslyimeamlkiiamgrsyiryhwnkfdllviivgivdvmviniiraddrpygvvstvrvfrfirvlrllrllkhvvpkiiailerqinkqrsfcydiakgyiqaeedikclieqiaghekvcieinkileknkqdalkelglmqrdypdivtavktkqavqtvintdfqalqymisgcivdknegaelykiillkrkqlatlpptiapptapellrnvmwlcdnehqleyiqekakkicfdygdvvskegdlpqgihlivsgmvklsgstprygvynkeiekhlaatpytdylgtgtiigevncltkqemeytvtcetavqtcfisandlleafdtfletpsledkiwrkialdialktlkealpnqdwaykicaqfsnvqvvdipnhtkhdiydatmddvilvhgavqdcqlgqcyyapcilpktchqvrgnatvtkllvirttnrgaqtssevcnplcqyhssrrrealgnvfsahstspgsvttdpnnligqkdkkkkdssmckv REMOTE DISCONNECTION EVENT DETECTED SERVER PORT 8000 DISCONNECTED BY USER XVI OUTPUT TERMINATED KEEPALIVE PROCESS COMPLETE RESUMING OUTPUT... PORT 8000 DISCONNECTION DETECTED RECONNECTING... (cont)
Luke Howard
t. he sequenced bills dna
Colton Taylor
Yes. Verily.
Julian Thomas
Right?
Even if it came from Rich's body, it's not worth shit without some chain of custody. Doesn't prove anything.
Leo Gray
REMOTE CONNECTION DETECTED... PORT 8000 CONNECTION ESTABLISHED REMOTE COMMAND ENTERED: C:\WINDOWS\SYSTEM32\PROXY7.EXE ENTER USERNAME: SPEAKEASY ENTER PASSWORD: HRCDUMP08312017ASSANGE ENTER WAYPOINT: TTTB FIREWALL ENABLED RESUMING OUTPUT... SEQ 6/25723 mqnmvwrkrydtllrqraignegkewrdtpstsnnkklrtpanyfimnlaasdflmsatqapvcffnsmhkewvlgdagcsfyafcgalfgitsmmtllaisvdrycvitkplqslkrstkkrsciiivfvwlyslgwsvcplfgwssyipeglmisctwdyvsyspanrsytmllcwcvffiplmiifhcylfmfltirstgrnvqklgssskrkksssqsiknewklakvafvaivvyvvswspyacvtliawagyarvltpysksvpaviakasaihnpiiyaiihpsysrvsfmsknkssdisaisatektwndveldpvetvhtklqppennsfstnaeekselpinapieekfsvspicpeeplkrplklnapelllltsslrasslpfdlnassrrksmdtsqaevhedpinssqdsletpilphiiiiptsettlseeqsltenieeentglysgpdknylllkgrlhsstgpvekl REMOTE COMMAND ENTERED: CTRL+C ENTER USERNAME: SPEAKEASY ENTER PASSWORD: HRCDUMP08312017ASSANGE ENTER WAYPOINT: TTTB ACCESS DENIED. OLD PASSWORD ENTERED. PASSWORD CHANGES EVERY 30 SECONDS. SEQ 7/25723 mqmdwlfiavisgigllssgvpgtqgaytteqcralngscnfyacfpknviigkcdwwgwsccartplerctakkgtctktgctktdtdhgpcdggaqccqrdpvkyckfhgnvcgrgkcpmdhipigeqcmpgypcckrdgpayckskggkclrrcsqivptdiigvcadgvpccksrqstg
David Cruz
i watched the video. his schizophrenia is starting to take over. happens to the best of them.
Landon Fisher
That's all Monica was trying to do
Colton Diaz
can someone explain to me why copy and pasting sequence data from a protein bank is indicative of anything? Even if he is in possession of a 'dna' sample, it could have literally be swabbed from anywhere
Tyler Reed
REMOTE COMMAND ENTERED: DELTREE C:\USERS\MARTIN /Y ENTER USERNAME: SPEAKEASY ENTER PASSWORD: OVERRIDE16 ENTER WAYPOINT: TTTB DELETING C:\USERS\MARTIN 26.3GB DELETED REMOTE COMMAND ENTERED: PING 23.7.52.135 ENTER USERNAME: SPEAKEASY ENTER PASSWORD: OVERRIDE16 ENTER WAYPOINT: TTTB PINGING 23.7.52.135 (SHKRELISWITCHICD) TRACE COMPLETE. REMOTE COMMAND ENTERED: RAC.EXE -VITALS -IP 23.7.52.135 ENTER USERNAME: SPEAKEASY ENTER PASSWORD: OVERRIDE16 ENTER WAYPOINT: TTTB REMOTE ACCESS CONTROL RESPONSE HR: 0 02: 0 SBP: 0 DBP: 0 LV STATUS: DISCONNECTED RV STATUS: DISCONNECTED
Adrian Sanchez
Basic bio lesson:
DNA -> mRNA -> protein
This is at best form a transcriptome (total mRNA), more likely a proteome (total protein).
Proteomes are unique to species so it should be obvious what species this is from soon.
Angel Edwards
How do you kill a lizard person if guns don't work? Would bludgeoning work or would you have to figure something else out
Adrian Long
Take away the heat lamp.
Sebastian Lewis
Fire. Obviously
Where have you been?
Colton Davis
post yfw it's reptile dna
Jason Long
call them a jew
Cameron Clark
HRC is either a clone or a goddamn reptile bitch.
Kevin Ward
...
Easton Rodriguez
wait is that the cash me outside chick?
Henry Jackson
>being this retarded
John Taylor
thank you user OUR REACH IS EVERYWHERE we have agents and sympathizers in every institution and at every level of government, be afraid commies, be very afraid
Oliver Bailey
>Female and is Caucasian which would imply that it is human DNA? >pls no bully
Kevin Ross
Id think just like anything else that breathes , In They live once the veil was lifted they were killed just like us.
Jackson Campbell
>>The rRNA is the most conserved part of the genomic sequence and can be used in identifying species >>identifying species >>species
Jose Brooks
rip larpfag
Caleb Martinez
I've never heard anyone refer to any other species of animal by their skin color so yeah it looks like this is human dna.
Nolan Roberts
he forgot to say he never takes solitary moonlight swims by the pier
Colton Ward
No you fool! Dont answer the door!!!
Adrian Brown
fake news
Gavin Stewart
...
Nicholas Adams
...
Owen Long
a worse LARP than the gorrillionth WH user
Jacob Watson
>hold on someone is knocking at my door... >ill brb guys.
Ok, you made me laugh
Lincoln Campbell
>Martin Shkreli Wiki page 2018 In 2017, the man who tried to kill niggers in Africa, proved Shapeshifting Reptilians run our planet
Cameron Murphy
Strange position to take, considering what you have on the thumb drive you think you have secure.
Also, look 14 days ago and ask how much more desperate is your life going to get?
Ethan Mitchell
anything reptilian in there?
Jacob Perry
Shall I remind you that dogs can be white or black dogs depending on who the owner is, as well as the the dog's temperament.
Austin Long
I need a lizardpeople happening in my life rn.
Ryder Jackson
hilldawg is a lizard ?
Josiah Jenkins
It's Hillzard now.
Oliver Martin
...
Logan Young
Just boasting. It's a lot easier to get Bill's DNA.
John Mitchell
does this have anything to do with covfefe?
Kevin Perry
What was said?
Jayden Ross
Fuck you too faggot
Sebastian Jones
wait... Hillary is killing jews?
Tyler Morales
>PROXY7.EXE so he's just larping, eh?
Joseph Richardson
What fucking program would be coded to dump out shit like this?
Garbage text like that isn't even useful with debugging, especially not for actual output.
Like seriously WHO TYPES THAT SHIT? At most you'd have --StartDump-- or something, not EXO PORTS ENGAGED, DISCONNECTION DETECTED, SOUND THE ALARMS bullshit.
It reads like someone using a terminal on fucking Star Trek.
He's fucking larping of course, and you idiots are lapping it up.
For someone with his supposed level of intellect and MONEY, you'd expect any "dead man's switch" type of system that posts to FACEBOOK to actually output something fucking useful and human readable to normies. Not that fucking larping bullshit.
Xavier Long
HILLARY IS LITERALLY HITLER
Carson Turner
Big if true
Christian Robinson
...
William Hughes
This. Fucking annoying. This whole threads a giant larp. This shrekleki nigger doesn't have HRC's dna.
Lincoln Wilson
He doesn't know about the ricin yet.
Parker Cruz
but I'm not speced for fire, and I never got enough shekels for the bigger guns
Justin Jones
is Shkreli ded?
Benjamin Thomas
these people are satanists, they don;t care about anyone involved with major world religions
Lincoln Hughes
larpy things - nothing important i fell for the larp and now if feel dumb
Christian Bailey
then leave
Julian Sanders
bump for the answer
Kayden Watson
The post said it was a biomedical student running a sequence on what was posted; and stated that initial findings were slow but that it was definitely a white / cauc female
Thomas Ross
>Garbage text like that isn't even useful with debugging, especially not for actual output.
The text in question is to let the user know what is happening with his script. That is the garbage you would find displayed on the terminal. I don't see how out of place it is. Assuming he wrote the script himself those are the words he choose to use.
Owen Edwards
>In National Treasure 4 "Zero Hour" Nic Cage takes the redpill and scrapes Bill Clinton's Jizz off of the REAL blue dress deep within the confines of Area 51, where he discovers a scaly secret that is truly out of this world.
Nathan Garcia
It's the genetics to create the ultimate virus. A weapon to surpass metal gear.
Elijah Nelson
Can someone tell me what the fuck is going on in this tread?
Nolan Jenkins
This fucking thread is INTENSE!!
Aiden Peterson
What the fuck would it even matter if he did have her DNA? Who the fuck would really even care? Plus it's utterly impossible to verify. Sure let me just set up a 20 billion dollar lab to clone up a copy and way 15 years to see if the face matches.
Mason Kelly
see
Levi Myers
Have you ever seen the x files? Remember the alien DNA? Well.
Samuel Long
Ah okay, well that's a load of bollocks.
Josiah Brown
HRC possibly has reptilian dna
Nolan Wright
i have no idea. some saying martin sent julian 10mil clinton emails, 30gb worth. others saying hillarys dna says she is a lizard see
Henry Harris
...
Jack Hill
Show the fucking emails not some retarded DNA sequence.
Daniel Harris
Back when Shkreli used to only have like 10 people on his stream we used to talk about million dollar extreme. He's also worn Pepe pins on TV. He's very much /ourguy/.
Noah Reyes
>implying this DNA is alien to earth
The reptiles have been here a long time user, this has always been their planet
Logan Lopez
Okey lads what was posted in those posts? I cant fucking contain myself, WHAT WAS POSTEDDDD FUGGGG
Lincoln Collins
honestly, i think this is all just nuts. really, just something we wont understand. crazy stuff, you know what I mean?
it's not even determined whether its DNA... so i think we should all just call it quits.
dont you think so too guys? everyone should just take a nap. all of us. dont you think?
Jeremiah Young
Shreli sent what looks like a dead man switch dont know if he is still alive sequences on fb post are amino acid sequences of a reptile dont know if its part of hillary dna streamed today going to trump tower being very paranoid ans saying he was being followed no signal since then
Juan Cooper
Fuck off with your normie meme
Jason Phillips
Yeah, it's absolute bullshit. But apparently summer never ended and all these retards are gobbling it up.