cont. from THIS IS NOT A DRILL DON'T LET THIS SLIDE
Alleged Martin Sup Forums post: >You guys really disappoint me. It's HRC's DNA. I made it public to show the lab tech's working with the Chandra Levy investigation I will not stay quiet if they choose the wrong path.
DNA, text can be found on his FB page (back up now)
Kayden Reed
>notorious troll posts saying he has evidence of conspiracy theory >Sup Forums believes every word You guys are retarded
Ian Ward
Fuck. Didn't black suburbans vote for Hillary?
Elijah Mitchell
It's a 100% match with Pogona vitticeps DNA.
>Pogona vitticeps >Species: Bearded dragon >"The belly of the dragon will drip water"
It's also an 88% match with the homologous protein in humans.
>88% >hitler-digits
HRC = Reptilian Hitler?
Asher King
results of IP trace >23.7.52.135 >its actually the fucking CIA
Ryan Wilson
...
Zachary Rivera
You got me bro. I absolutely, 100% uncritically believe in Martin Shikreli's hypothesis that Hillary Clinton is a reptilian. Fuck, I sure feel retarded now. Good thing we have big brains like you on board.
Easton Morris
LEFT VENTRICULAR CONNECTION DISCONNECTION EVENT DETECTED ECHO NO CONNECTION TO ICD PORT 8000 ESTABLISHED BY USER: SPEAKEASY AUTOMATIC SWITCH OUTPUT ENABLED EXOME SEQUENCE DUMP BEGIN SEQ 1/25723 msgdemifdptmskkkrkkrkpfmldeeggdtqaeetqlsetkevepepvedkdteadeedsrkkdasndlddltffnqkkkkkktkkifdideaeegikdlkiegdaqepvepeddldimlgkkkkkktvkfpdedevldkdealededskkddgisfssqsgpawagserdytydellnrvfnimreknpdmvagekrkfvmkppqvvrvgtkktsfvnftdickllhrqpkhllafllaelgtsgsidgnnqlvikgrfqqkqienvlrryikeyvtchtcrspdtilqkdtrlyflqcetchsrcsvasiktgfqavtgkraqlrakan SEQ 2/25723 meyrnlllgfllccillatsysymileekkdtnksavhtskikfpdlppisiveltktsmklsrkeaernksmkkkaqqkkaprpkpppppncvatwasckpssrpccdfcafcycrlfqtvcycrmgnpnc SEQ 3/25723 mnseskkqlnivvlgtafmfmftafqtcgnvaqtvitnlnntdfhgsgytsmaviygvfsasnlispsvvaiigpqismfisgifysiyiaifiqpstwtfytasvflgiaaavlwtaqgncltvnsnehtigrnsgifwallqsslffgnlyiyfawqgkfhisesdrrtvfialtvislvgtvlfflirtpeesnseeeppadnlmertsgpsvmtkavdafkrsiklcatkeivllsvttaytgleltffsgvygtcigavnkfgneeksliglsgifigigeilgggifgllsksnqfgrnpvvmlgivvhfiafylifynipndapiasidgtdsrafmepskevaifcsfllglgdscfntqllsilgflysedsapafaifkfiqsvcaaiayfysnylflqwqllimavvgffgtisffsvewaapafvakrtdyssi SEQ 4/25723 mqqlamsdtsaekphpshhstgavqmrirsvnsphdrhsqsksmilpenlkviepischrrnhsqhnltlpefispleqtvikegyllkakiadggkklrknwtsswlvltgqkiefykepkqpavanlkagyktewvdlrgahlewakeksskknvfqittlsgnevllqsdiefvilewfhaiknaieklpkekskmsrnneykimrssssellssfetdskepkpenrrslifrlnysisdtteinrvksrlkkfitrrpslrtlqekgiikgldvdgiyrvsgnlatiqklrfvvnqeeklnlddsqwedihvvtgalkmffrelpeplfpycffeqfvevikiqdytnrvkavrnlvqklprpnydtmkilfqhlqkiaakenmnlmtpqslgivfgptllrpeketgsmavymmyqnqlvelmlseyskifssekd
even the ones that were scrapped years ago were registered to vote in Chicago
Grayson Kelly
madfnvgaaathfipgvspvpgsaavaadlsgskyngdkdvrdfhilrrnqpvillvivasfavgallrtilkrkkipilvivffigviigtsqlpfvktiaeidpvlflhlfspviiftaafemdfyifqksfwqvlilavlgfvmncaslgwltyktnqhkwtrddniifgiilcttdpdlsvasiknigiskilinlikgeslfngatttivfelyrdlvnhsyqkivqeifvkltlkifgsavfgfvsskmvtfwlanifndritevilsfsmtylvfylaewlgmsgiiavcvlgllmdsvsfspgmdvvlskfwsmltflaqimiyltmgiviaqktfpymnfhsifyivtiylslnliralvtfilspllnrfgygfnwrwgavivwsgvrglftlnmalevsqtpnensaeleiknmillysvavslltlvinsttveklvmtlglcnvslpkrvalhnafqrikqmeannftmlkldkfladanwalaekcisvedpkeidsvvkqlmktfrcpncnvntplensqqmadimeearlrlltaqiasyqkqynsgmlsqkatqtligaaecyydvpgkfmnihevkkywedkgllmsmkkylsdwaynvkpetsrtsenrflklcqlivyndtfehtsslitylnfipillrliptvnmeflpqlkicnyyflslyimeamlkiiamgrsyiryhwnkfdllviivgivdvmviniiraddrpygvvstvrvfrfirvlrllrllkhvvpkiiailerqinkqrsfcydiakgyiqaeedikclieqiaghekvcieinkileknkqdalkelglmqrdypdivtavktkqavqtvintdfqalqymisgcivdknegaelykiillkrkqlatlpptiapptapellrnvmwlcdnehqleyiqekakkicfdygdvvskegdlpqgihlivsgmvklsgstprygvynkeiekhlaatpytdylgtgtiigevncltkqemeytvtcetavqtcfisandlleafdtfletpsledkiwrkialdialktlkealpnqdwaykicaqfsnvqvvdipnhtkhdiydatmddvilvhgavqdcqlgqcyyapcilpktchqvrgnatvtkllvirttnrgaqtssevcnplcqyhssrrrealgnvfsahstspgsvttdpnnligqkdkkkkdssmckv REMOTE DISCONNECTION EVENT DETECTED SERVER PORT 8000 DISCONNECTED BY USER XVI OUTPUT TERMINATED KEEPALIVE PROCESS COMPLETE RESUMING OUTPUT... PORT 8000 DISCONNECTION DETECTED RECONNECTING... (cont)
Ian Rogers
REMOTE CONNECTION DETECTED... PORT 8000 CONNECTION ESTABLISHED REMOTE COMMAND ENTERED: C:\WINDOWS\SYSTEM32\PROXY7.EXE ENTER USERNAME: SPEAKEASY ENTER PASSWORD: HRCDUMP08312017ASSANGE ENTER WAYPOINT: TTTB FIREWALL ENABLED RESUMING OUTPUT... SEQ 6/25723 mqnmvwrkrydtllrqraignegkewrdtpstsnnkklrtpanyfimnlaasdflmsatqapvcffnsmhkewvlgdagcsfyafcgalfgitsmmtllaisvdrycvitkplqslkrstkkrsciiivfvwlyslgwsvcplfgwssyipeglmisctwdyvsyspanrsytmllcwcvffiplmiifhcylfmfltirstgrnvqklgssskrkksssqsiknewklakvafvaivvyvvswspyacvtliawagyarvltpysksvpaviakasaihnpiiyaiihpsysrvsfmsknkssdisaisatektwndveldpvetvhtklqppennsfstnaeekselpinapieekfsvspicpeeplkrplklnapelllltsslrasslpfdlnassrrksmdtsqaevhedpinssqdsletpilphiiiiptsettlseeqsltenieeentglysgpdknylllkgrlhsstgpvekl REMOTE COMMAND ENTERED: CTRL+C ENTER USERNAME: SPEAKEASY ENTER PASSWORD: HRCDUMP08312017ASSANGE ENTER WAYPOINT: TTTB ACCESS DENIED. OLD PASSWORD ENTERED. PASSWORD CHANGES EVERY 30 SECONDS. SEQ 7/25723 mqmdwlfiavisgigllssgvpgtqgaytteqcralngscnfyacfpknviigkcdwwgwsccartplerctakkgtctktgctktdtdhgpcdggaqccqrdpvkyckfhgnvcgrgkcpmdhipigeqcmpgypcckrdgpayckskggkclrrcsqivptdiigvcadgvpccksrqstg
Owen Barnes
REMOTE COMMAND ENTERED: DELTREE C:\USERS\MARTIN /Y ENTER USERNAME: SPEAKEASY ENTER PASSWORD: OVERRIDE16 ENTER WAYPOINT: TTTB DELETING C:\USERS\MARTIN 26.3GB DELETED REMOTE COMMAND ENTERED: PING 23.7.52.135 ENTER USERNAME: SPEAKEASY ENTER PASSWORD: OVERRIDE16 ENTER WAYPOINT: TTTB PINGING 23.7.52.135 (SHKRELISWITCHICD) TRACE COMPLETE. REMOTE COMMAND ENTERED: RAC.EXE -VITALS -IP 23.7.52.135 ENTER USERNAME: SPEAKEASY ENTER PASSWORD: OVERRIDE16 ENTER WAYPOINT: TTTB REMOTE ACCESS CONTROL RESPONSE HR: 0 02: 0 SBP: 0 DBP: 0 LV STATUS: DISCONNECTED RV STATUS: DISCONNECTED
Liam Perry
Bane?
Elijah Taylor
>on the run >time to sit around and code stupid shit on the internet
Daniel Gray
this is getting spoopy
Jonathan Smith
He is live on youtube. He is explaining everything.
doesn't the CIA not use a public accessible internet? inst it more of an intranet?
Adam Cox
>reptilian Redpillian
Elijah King
He is streaming on youtube youtu.be/1Dcz2MLYG6Y and I am not sure why... but he is trying to get a blood sample of himself.
Noah Lopez
Martin thinks HRC killed Chandra Levy and is using his wealth to conduct his own private investigation. He obtained HRC dna as part of this investigation, according to his FB he was at Trump tower having a meeting yesterday.
It's to say he has more samples and (((where))) he got them from.
>Hint: A crime scene.
Kevin Mitchell
oh my god I've run the sequence and it comes back as THIS
Jace Perez
What are we suppose to do with it? Clone another Hillary? It's useless on its own unless we have other people's to compare it to. We would need Bill's as well to verify Chelsea is in fact his.
Chase Robinson
That's not what DNA sequence looks like tho. Am I retarded?
He just said he posted lizard DNA as a joke. You're all retarded
Thomas Fisher
So what? Its DNA. Why you BTFO over programming code?
Parker Jenkins
It's actually some amino acid or something. I don't think we're on the same page as the "TCAG" stuff.
Isaac Foster
THIS GUY FUCKS
Angel Russell
not going lie i would suck Martin Shkreli's dik
Matthew Long
it's probably encoded so it takes less space
Tyler Reed
What type of chip is he holding?
Blake James
its RNA or amino acids i believe
Thomas Perry
ok commie
Nicholas Baker
I read a thread on it earlier and it isn't any known model of chip, but it resembles an encrypted decoder chip
Brandon Williams
What is this larping faggot even doing right now?
Asher Evans
>hilary dna is mostly human >traces of something close to but not exactly a bearded dragon
well, there are 3 possibilities 1) martins trolling 2) the establishment is trolling and martin is being trolled too 3) the establishment is trolling through martin and martin knows it because he's part of it 4) she really is a human-animal chimera and possibly many of the elite are
4 is not impossible. MIT technology review already admitted that there are human-animal chimera embryos growing in labs across north america. but officially they're never grown to term. but it's quite possible a breakways civilization with secret research projects has had the ability to make human hybrids for some time.
maybe the elites top puppets are part reptillian, for maximum coldness and loyalty or something.
or possibility 5, which involves aliens ay lmao. but if that turns out to be the case i'll assume it's all a lie and part of project blue beam to bring in a one world government using the excuse that we have to unite against aliens, but the aliens are faked.
Lucas Campbell
Are we playing a known psychopath's shitty ARG now? Why is this being taken seriously?
Shkreli is a really obvious psychopath. He has the right physiognomy, he's charismatic as fuck, he only cares about himself, etc. He is trolling you guys because he finds it entertaining. How the fuck are you falling for this?
Given his mental illness I imagine he genuinely believes he isn't going to jail, but somewhere in the back of his mind he probably knows otherwise. I expect he'll do more and more retarded shit for attention as his sentencing draws nearer.
Christian Parker
Why would she want to kill Levy? Did she have a hate boner for Gary Condit?
Kevin Brown
Why is he trying to get some of his own blood on the youtube channel?
Luis Cruz
Fucking Protein Sequence
Matthew Scott
Shrek talks baby talk to his cat... now I've seen everything He likes cats better than humans
Ethan Peterson
he loves his pussy
Lincoln Martin
Good thing you acknowledge your limits, user. Imagine paying attention to this literal troll. >reptilian Redpillian Shill, he died in this moment :
Jack Williams
1 and 4. The Elite shit bricks when the larps have large chunks of truth in them
Ryder Hernandez
>4 is not impossible. MIT technology review already admitted You are FAR too trusting. All they need to do is pull a few scientists that have participated in such experiments to do the same thing without constraints. I wouldn't be at all surprised with Hillary being some kind of abomination since she's always had handlers. Bill too. Don't really understand why everyone is so soft on Bill. He's just as involved with the evil bullshit as Hillary. Quit trying to think that famous people are your friends.
Anthony Williams
>Bearded Dragon Lets say the reptilian alien /x/ meme is true. Bearded dragons are from the order Squamata. This order is relatively new as shit compared to all reptilian-like organisms to have ever existed and that's assuming the Anukki meme has the reptilians originally native to earth.
He's trolling.
Henry Hall
Bump just in case
Thomas Collins
Hillary submitted her DNA sample to 23andme for analysis
One of the rogue interns stole it from the vault
Brody Bell
People like Bill because Bill fucked over other countries the US benefit, minus NAFTA.
Honestly if Bill ran today and you got rid of NAFTA, he'd be a great Republican candidate who happens to use the CIA to bomb anyone he doesn't like. He'd be some sort of Bush-Trump hybrid.
Adam Ward
Your DNA is close to 3 billion base pairs, encoding about 1 billion amino acids. skreli just posted gibberish.
Ian Carter
how am i trusting? did you even read my full post? i already said basically whjat you said except i additionally implied a breakaway civilization that has many similar secret projects on the go. >Quit trying to think that famous people are your friends. when did i do that? >Don't really understand why everyone is so soft on Bill who is everyone? he's a rapist, this is widely known
Carter Ramirez
how can we confirm this is even martin? could just be a tape playing of moments when he was sitting around. and in the chat room it could be anyone typing. has anyone heard him physically talk from his mouth about whats going on?
Grayson Fisher
Because he already replied to people in the chat genius
Joseph Powell
As much as I despise Hillary, Martin's a bigger scumbag.
Camden Sanders
david ike lizards confirmed!
Ryder Bailey
replied with his mouth or by typing in the chat? i wasn't there, why insult me?
Gabriel Williams
and he was saying the exact same words he posted on his facebook website..
Julian Jenkins
with his voice
Ryder Butler
People don't realize how close the Clintons are to Republicans.
Samuel Anderson
his fucking mouth he spoke he spoke words
Jordan Bennett
More than likely he's doing this just to bump his subscriber list on jewtube and now with the live stream hopes to cash in on any super chat donations.
Isaac Edwards
t. Bluepilled Idiot Go regurgitate whatever the mainstream news tells you to think on Reddit.
Owen Thompson
Hi fellow based peed. I hear you're new from T_D. I know you're still shedding you're layers of bluepill right now but it's time to take the shkrelpill. Look up his side of the story of whatever controversy he's had. He is BASTE and misrepresented.
Correct, they are red democrats just like you have blue republicans
Josiah Jones
It would be awesome if we start flooding the chat asking him about the DNA. He is acting pretty weird.
Adrian Moore
Please do so , ask him what he thinks about jazz music.
Luke Wood
100%
William Flores
I was in there just a little while ago and it seemed like he was trying to get a sample of his own blood.
Ethan Ward
This will probably be more interesting than the shit you're selling. Go be a faggot elsewhere.
Oliver Reed
Can someone explain this shit to me? Why would he have Hillary's DNA and what is Carter 5?
Also the usb with emails?
Ayden Powell
well, amazing things can be done with cg these days. look at assange, he probably died years ago. leaked documents already admit that "in the future" cg will be indistinguishable to the real thing. this was a leaked army document and no i don't remember where it is, it's something i heard about on alex jones show years ago so i looked it up and confirmed that its real.
Dominic Evans
that's an autistic lookin' hamster
Kevin Lee
can someone give me a quick rundown on what her dna means?
Zachary Scott
so for all we know, they captured martin. and already had a cg replacement set up and they can just type whatever they want the cg animation to say. maybe an ai does it. i'm not saying that's likely though, merely vaguely possible. if martin never leaves his apartment ever again that'll be a sign
Grayson Torres
Martin is a master troll, we'll have to wait a couple days to see if the nigga is larping again.
Owen Bell
Didn't he say he'd release all his secret Nirvana music stash if Trump won? Still waiting on that!
Christian Jackson
traces of lizzard proteins.
otherkin confirmed
Grayson Rogers
Not possible. unless the clone has access to all of his accounts. He is on FB, Discord and Youtube... he has been interacting with people.
Jaxon Carter
kek, bretty good
Carter Bell
Basically is the aminoacidic sequence encoded by the exome, the parto of the dna that is actually a protein coding sequence.
Dna is a 4 letter code (ATGC) to produce proteins of a given aminoacid sequence. There are 20 different aminoacid and they are the building blocks of proteins, which are folded chains of aminoacids.
each aminoacid is encoded by a triplet of nucleotides (the 4 letters of dna).
Not all dna is a coding sequence, but large part of it is spliced out before producing the protein from the coding sequence. Non coding sequence often contain regulatory region or intragenic junk with no function.
what you see in the sequence are letters that encode for aminoacid. K is lysine, d is aspartic acid, r is arginine and so on.
Samuel Fisher
>junk with no function no known function*
Angel Myers
Stop being fucking retarded. There are literally no ATGC or ATUs or any of that bullshit. Dumb ass. Not one nucleotide in site.
Eli Nelson
This Shkreli is a rat faced LARPing little weasel who has never come through with any of his promises
Lucas Perez
I did see that one of the ip's goes to Cambridge, MA. That's where MIT is. MIT for over decades has create human-animal chimeras. HOLY FUCK HE WAS RIGHT!!
Alexander Martinez
i hope someone destroys those statues
Ryan Garcia
>the clone cg computer graphics i'm not suggesting they grew a martin clone, though i suppose they could in theory
and come on, the establishment has all your fb, discord, youtube data. everything you've ever done or said online, they have. that's not even conspiracy